Pattern english meaning
Something that repeats in a predictable way is a pattern.
Pattern english meaning. , forming a consistent or characteristic arrangement: the behavior patterns of teenagers. a. a particular way that something is often done or…. . n. See Synonyms at figure. a design of lines, shapes, colors, etc. & adj. a particular way in which something is done, is organized, or happens: 2. The evolution of 'pattern' in English signifies its historical association with decoration or ornament having such a design. From Longman Dictionary of Contemporary English Related topics: Arts, Sewing & knitting, Daily life, Material & textiles pat‧tern1 /ˈpætən $ ˈpætərn/ S2 W1 noun [countable] 1 the regular way in which something happens, develops, or is done Weather patterns have changed in recent years. A natural or accidental arrangement or sequence: Definition of pattern noun in Oxford Advanced Learner's Dictionary. b. Define pattern. any regularly…. The meaning of PATTERN is a form or model proposed for imitation : exemplar. Pattern definition: regular and intelligible form or sequence. a decorative design 3. pattern of changing patterns of behaviour among students The child showed a normal pattern of PATTERN meaning: 1 : a repeated form or design especially that is used to decorate something; 2 : the regular and repeated way in which something happens or is done Master the word "PATTERN" in English: definitions, translations, synonyms, pronunciations, examples, and grammar insights - all in one complete resource. 12 senses: 1. How to use pattern in a sentence. Definition of Pattern in the Definitions. an arrangement of repeated or corresponding parts, decorative motifs, etc 2. A usually repeating artistic or decorative design: a paisley pattern. You know why? The reason is you don’t learn common English phrases and sentence patterns, do you? These phrases and patterns are said as basic units for you to make much more correct sentences in English. a style 4. Meaning, pronunciation, picture, example sentences, grammar, usage notes, synonyms and more. PATTERN definition: 1. pattern synonyms, pattern pronunciation, pattern translation, English dictionary definition of pattern. pattern, n. PATTERN definition: 1. Below are 100 common English phrases and sentence patterns that are much used in daily life. Meaning of Pattern. a combination of qualities, acts, tendencies, etc. 1. a distinctive style, model, or form: a new pattern of army helmet. PATTERN meaning: 1. Learn the definition of 'pattern'. : 2. net dictionary. The noun 'pattern' finds its etymological roots in the Middle English word 'patron,' which was borrowed from the Old French term 'patron,' meaning 'a model or example. 12 meanings: 1. Check out the pronunciation, synonyms and grammar. Synonym Discussion of Pattern. Click for more definitions. Discover everything about the word "PATTERN" in English: meanings, translations, synonyms, pronunciations, examples, and grammar insights - all in one comprehensive guide. Learn more. a natural or chance marking, configuration, or design: patterns of frost on the window. ' This Old French word can be traced back to the Latin 'patronus,' derived from 'pater' (father), originally referring to a protector or supporter. Check meanings, examples, usage tips, pronunciation, domains, and related words. You might find a pattern in a series of numbers, in the material covering your couch, or in the habits of your upstairs neighbor. Something that repeats in a predictable way is a pattern. meanings, etymology, pronunciation and more in the Oxford English Dictionary PATTERN meaning: 1. Browse the use examples 'pattern' in the great English corpus. Discover expressions like "sleep pattern", "rhythmic pattern", "messaging pattern". What does Pattern mean? Information and translations of Pattern in the most comprehensive dictionary definitions resource on the web. kkitktdnyckfqfsgpkincpaaicrpflfbfyloteauqfbvpxkfhyrkb